{"product_id":"proteintech-16241-1-ap","title":"Proteintech, 16241-1-AP, MRPL13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPL13 (16241-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL13 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat,   monkey samples\n16241-1-AP targets MRPL13 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat,   monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  mouse lung tissue,  Jurkat cells,  COS-7 cells,  rat lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRPL13, also named as 39S ribosomal protein L13, mitochondrial or L13mt, is a 178 amino acid protein, which belongs to the ribosomal protein L13P family. MRPL13 localizes in the mitochondrion and interacts with OXA1L. MRPL13 is involved in mitochondrial proteins biosynthesis, ribosomal structure and biogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9105 Product name: Recombinant human MRPL13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-178 aa of BC009190 Sequence: MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRL Predict reactive species\nFull Name: mitochondrial ribosomal protein L13\nCalculated Molecular Weight: 178 aa, 21 kDa\nObserved Molecular Weight: 20-23 kDa\nGenBank Accession Number: BC009190\nGene Symbol: MRPL13\nGene ID (NCBI): 28998\nRRID: AB_2145705\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934918313,"sku":"16241-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16241-1-ap","provider":"Iright","version":"1.0","type":"link"}