{"product_id":"proteintech-16264-1-ap","title":"Proteintech, 16264-1-AP, PQBP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PQBP1 (16264-1-AP) by Proteintech is a Polyclonal antibody targeting PQBP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16264-1-AP targets PQBP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  mouse brain tissue,  mouse skeletal muscle tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human breast cancer tissue, human colon tissue,  mouse colon tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPQBP1 (Polyglutamine-binding protein 1) is also named as NPW38 and JM26. PQBP1 senses extrinsic tau 3R\/4R proteins by direct interaction and triggers an innate immune response by activating a cyclic GMP-AMP synthase (cGAS)-Stimulator of interferon genes (STING) pathway (PMID: 34782623).  PQBP1 is abundantly expressed in the central nervous system during development. PQBP1 is a component of the precatalytic spliceosome (B complex) that is involved in splicing. PQBP1 was predominantly localized in the cell nucleus. PQBP1 is overexpressed in various cancer types including breast cancer, colon cancer, and glioblastoma (PMID: 38342602).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9329 Product name: Recombinant human PQBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC012358 Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD Predict reactive species\nFull Name: polyglutamine binding protein 1\nCalculated Molecular Weight: 265 aa, 30 kDa\nObserved Molecular Weight: 30-32 kDa\nGenBank Accession Number: BC012358\nGene Symbol: PQBP1\nGene ID (NCBI): 10084\nRRID: AB_10792928\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60828\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869424341161,"sku":"16264-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16264-1-ap","provider":"Iright","version":"1.0","type":"link"}