{"product_id":"proteintech-16334-1-ap","title":"Proteintech, 16334-1-AP, GPR146 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR146 (16334-1-AP) by Proteintech is a Polyclonal antibody targeting GPR146 in IHC, ELISA applications with reactivity to human, mouse samples\n16334-1-AP targets GPR146 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAs a member of GPCRs, GPR146 (G protein-coupled receptor 146) was initially discovered as a c-peptide signal body. GPR146 may act as a c peptide receptor to interact with proinsulin c-peptide to regulate insulin levels (PMID: 37926274). Mechanically, GPR146 induces hepatic sterol regulatory element binding protein 2 (SREBP2) via the activation of extracellular signal-regulated kinase 1\/2 (ERK1\/2) signaling, consequently resulting in hepatic low-density lipoprotein (VLDL) secretion (PMID: 32491159).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9456 Product name: Recombinant human GPR146 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-333 aa of BC014241 Sequence: SRVRREDTPLDRDTGRLEPSAHRLLVATVCTQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDFSKLLAFSSSFVTPLLYRYMNQSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA Predict reactive species\nFull Name: G protein-coupled receptor 146\nCalculated Molecular Weight: 333 aa, 37 kDa\nGenBank Accession Number: BC014241\nGene Symbol: GPR146\nGene ID (NCBI): 115330\nRRID: AB_3669240\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CH1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887656194217,"sku":"16334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16334-1-ap","provider":"Iright","version":"1.0","type":"link"}