{"product_id":"proteintech-16342-1-ap","title":"Proteintech, 16342-1-AP, SLC35A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC35A1 (16342-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35A1 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16342-1-AP targets SLC35A1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissue, mouse testis tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 35 member A1 (SLC35A1) , also named as CMP-sialic acid transporter (CST) , is responsible for transferring CMP-sialic acid from the cytosol through Golgi membranes, thus playing a vital role in the terminal sialylation of glycan structures.  Slc35a1 deficiency causes thrombocytopenia due to impaired megakaryocytopoiesis and excessive platelet clearance in the liver. In addition, SCL35A1 acts independently from sialic acid in functional α-DG O-mannosylation(PMID: 25552652).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9524 Product name: Recombinant human SLC35A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC017807 Sequence: MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTA Predict reactive species\nFull Name: solute carrier family 35 (CMP-sialic acid transporter), member A1\nCalculated Molecular Weight: 337 aa, 37 kDa\nObserved Molecular Weight: 30-33 kDa\nGenBank Accession Number: BC017807\nGene Symbol: SLC35A1\nGene ID (NCBI): 10559\nRRID: AB_2190077\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78382\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869499969705,"sku":"16342-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16342-1-ap","provider":"Iright","version":"1.0","type":"link"}