{"product_id":"proteintech-16364-1-ap","title":"Proteintech, 16364-1-AP, VAV1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAV1 (16364-1-AP) by Proteintech is a Polyclonal antibody targeting VAV1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n16364-1-AP targets VAV1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HL-60 cells,  Ramos cells,  Raji cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human breast cancer tissue, human brain tissue,  human heart tissue,  human kidney tissue,  human liver tissue,  human lung tissue,  human lymphoma tissue,  human spleen tissue,  human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVav proteins mainly act as enzymes that catalyze the activation step of Rho subfamily GTPases during cell signaling. There are three family members:VAV1, VAV2 and VAV3. Vav1 is specifically expressed in the hematopoietic system, whereas Vav2 and Vav3 are more ubiquitously expressed (PMID:14607270). Vav1 is physiologically active as a GDP\/GTP nucleotide exchange factor (GEF) in the hematopoietic system (PMID:31654719).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, gecko\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9049 Product name: Recombinant human VAV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 442-790 aa of BC013361 Sequence: EQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Predict reactive species\nFull Name: vav 1 guanine nucleotide exchange factor\nCalculated Molecular Weight: 845 aa, 98 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: BC013361\nGene Symbol: VAV1\nGene ID (NCBI): 7409\nRRID: AB_2213571\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15498\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961919145,"sku":"16364-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16364-1-ap","provider":"Iright","version":"1.0","type":"link"}