{"product_id":"proteintech-16365-1-ap","title":"Proteintech, 16365-1-AP, HNRNPU Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HNRNPU (16365-1-AP) by Proteintech is a Polyclonal antibody targeting HNRNPU in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n16365-1-AP targets HNRNPU in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHNRNPU, also named as HNRPU, SAFA, and U21.1, is a 825 amino acid protein, which is extensively phosphorylated. HNRNPU as a component of ribonucleosomes localized in cytoplasmic mRNP granules containing untranslated mRNAs. HNRNPU is a component of the CRD-mediated complex that promotes MYC mRNA stabilization. HNRNPU Plays a role in the circadian regulation of the core clock component ARNTL\/BMAL1 transcription. The calculated molecular weight of HNRNPU is 90 kDa, but the 120 kDa HNRNPU protein is an abundant nucleoplasmic phosphoprotein that can be crosslinked to pre-mRNA in intact cells by UV light (PMID: 1628625).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9151 Product name: Recombinant human HNRNPU protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 462-806 aa of BC003367 Sequence: LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY Predict reactive species\nFull Name: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)\nCalculated Molecular Weight: 91 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC003367\nGene Symbol: HNRNPU\nGene ID (NCBI): 3192\nRRID: AB_10596481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00839\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934262953,"sku":"16365-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16365-1-ap","provider":"Iright","version":"1.0","type":"link"}