{"product_id":"proteintech-16368-1-ap","title":"Proteintech, 16368-1-AP, FZR1\/Cdh1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FZR1\/Cdh1 (16368-1-AP) by Proteintech is a Polyclonal antibody targeting FZR1\/Cdh1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n16368-1-AP targets FZR1\/Cdh1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HMy2.CIR cells, C6 cells,  HEK-293 cells,  HepG2 cells,  mouse liver tissue,  HeLa cells,  NIH\/3T3 cells,  mouse heart tissue,  rat heart tissue,  Jurkat cells\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human liver tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFZR1 gene, also named as FYR, FZR and KIAA1242, has been previously shown to be mutated in lobular breast carcinomas. Direct evidence of FZR1 mutations triggering tumorigenesis has been investigated. FZR1 is a key regulator of ligase activity of the anaphase promoting complex\/cyclosome (APC\/C) which is playing vital role s in cell cycle progression. There are 7 WD-repeat domains in FZR1. Upon phosphorylation and dephosphorylation, it interacts with other components to modulate cell mitosis. This gene is different to E-cadherin (CDH1)which is an epithelial cell adhesion molecule. It has 55 kDa, 54 kDa and 45 kDa isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9201 Product name: Recombinant human FZR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 217-342 aa of BC013413 Sequence: SQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNH Predict reactive species\nFull Name: fizzy\/cell division cycle 20 related 1 (Drosophila)\nCalculated Molecular Weight: 493 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC013413\nGene Symbol: FZR1\nGene ID (NCBI): 51343\nRRID: AB_2107380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UM11\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868911489193,"sku":"16368-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16368-1-ap","provider":"Iright","version":"1.0","type":"link"}