{"product_id":"proteintech-16406-1-ap","title":"Proteintech, 16406-1-AP, YIF1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YIF1B (16406-1-AP) by Proteintech is a Polyclonal antibody targeting YIF1B in WB, ELISA applications with reactivity to human, mouse, rat samples\n16406-1-AP targets YIF1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYIF1B is an intracellular membrane-bound protein belonging to the Yip family, a trafficking protein orthologue of YIF1P that was initially identified in Saccharomyces cerevisiae as interacting with YIP1P and essential for secretion.  YIF1B is expressed in various tissues, especially in brain neurons (PMID: 33103737). YIF1B is localized in the intermediate compartment between the endoplasmic reticulum (ER) and the Golgi apparatus (PMID: 26077767). Western blot analysis detected YIF1B at an apparent molecular mass of 31 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9538 Product name: Recombinant human YIF1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-156 aa of BC014974 Sequence: MHPAGLAAAAAGTPRLPSKRRIPVSQPGMADPHQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQDTPVAPRFDVNAPDLYI Predict reactive species\nFull Name: Yip1 interacting factor homolog B (S. cerevisiae)\nCalculated Molecular Weight: 294 aa, 32 kDa\nObserved Molecular Weight: 31~34 kDa\nGenBank Accession Number: BC014974\nGene Symbol: YIF1B\nGene ID (NCBI): 90522\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5BJH7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925809321,"sku":"16406-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16406-1-ap","provider":"Iright","version":"1.0","type":"link"}