{"product_id":"proteintech-16457-1-ap","title":"Proteintech, 16457-1-AP, MRPS35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRPS35 (16457-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS35 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16457-1-AP targets MRPS35 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human heart tissue,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammalian mitochondrial ribosomes (mitoribosomes) are responsible for protein synthesis within the mitochondrion. The mitoribosomes are composed of a 4:1 ratio of \nprotein to RNA, with the proteins forming two subunits, the 28S subunit and the 39S subunit. Across species, the proteins that make up the mitoribosome subunits vary \n\ngreatly in sequence, preventing easy recognition by sequence homology. MRPS35 (mitochondrial ribosomal protein S35), also known as MDS023, MRPS28 or HDCMD11P, is a \n323 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 28S ribosomal subunit and works in conjunction with other MRPs to \n\nmediate protein synthesis. Existing as two alternatively spliced isoforms, MRPS35 is encoded by a gene located on human chromosome 10, which houses over 1,200 genes \nand comprises nearly 4.5% of the human genome. This antibody is a rabbit polyclonal antibody raised against the full length MRPS35 protein. It specifically reacts with \nthe 37kd MRPS35protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9430 Product name: Recombinant human MRPS35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-323 aa of BC015862 Sequence: MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT Predict reactive species\nFull Name: mitochondrial ribosomal protein S35\nCalculated Molecular Weight: 323 aa, 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC015862\nGene Symbol: MRPS35\nGene ID (NCBI): 60488\nRRID: AB_2146521\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P82673\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868859224233,"sku":"16457-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16457-1-ap","provider":"Iright","version":"1.0","type":"link"}