{"product_id":"proteintech-16465-1-ap","title":"Proteintech, 16465-1-AP, HGD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HGD (16465-1-AP) by Proteintech is a Polyclonal antibody targeting HGD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16465-1-AP targets HGD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  rat liver tissue,  mouse liver tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHomogentisate1,2-dioxygenase (HGD), also named as HGO, is a mononuclear Fe(II)-dependent oxygenase that catalyzes the third step in the pathway for the catabolism of tyrosine, the conversion of homogentisate (HG) to maleylacetoacetate (MAA) and it can exsit as a dimer or trimer(PMID:14678794). HGD consists of a single type of subunit with no intermolecular disulfide bridges and requires Fe2+ as a cofactor(PMID: 7705358). Defects in HGD are the cause of alkaptonuria (AKU)(PMID:10594001).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9544 Product name: Recombinant human HGD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC020792 Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL Predict reactive species\nFull Name: homogentisate 1,2-dioxygenase (homogentisate oxidase)\nCalculated Molecular Weight: 37 kDa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC020792\nGene Symbol: HGD\nGene ID (NCBI): 3081\nRRID: AB_2248397\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q93099\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887667302569,"sku":"16465-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16465-1-ap","provider":"Iright","version":"1.0","type":"link"}