{"product_id":"proteintech-16470-1-ap","title":"Proteintech, 16470-1-AP, PCSK5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCSK5 (16470-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK5 in IHC, ELISA applications with reactivity to human, mouse samples\n16470-1-AP targets PCSK5 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissue, human brain tissue,  human skin tissue,  human heart tissue,  human testis tissue,  human spleen tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPC5 ,a mammalian kex2-like processing endoprotease, mediates posttranslational endoproteolytic processing for several integrin alpha subunits.It has been identified in rat and mouse endocrine and neuroendocrine tissues,and is encoded by multiple mRNAs that generate two splice variant isoforms referred to as PC5A (102KDa) and PC5B (207KDa) .PC5A is smaller than PC5B and  it can be processed into two forms (117 kDa and 65 kDa) in neuronal cells(PMID:11457520).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9552 Product name: Recombinant human PC5 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 32-351 aa of BC012064 Sequence: TRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEEC Predict reactive species\nFull Name: proprotein convertase subtilisin\/kexin type 5\nCalculated Molecular Weight: 102 kDa, 207 kDa\nObserved Molecular Weight: 210 kDa\nGenBank Accession Number: BC012064\nGene Symbol: PCSK5\nGene ID (NCBI): 5125\nRRID: AB_2283381\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92824\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869421523113,"sku":"16470-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16470-1-ap","provider":"Iright","version":"1.0","type":"link"}