{"product_id":"proteintech-16481-1-ap","title":"Proteintech, 16481-1-AP, PHAX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHAX (16481-1-AP) by Proteintech is a Polyclonal antibody targeting PHAX in WB, IF\/ICC, ELISA applications with reactivity to human samples\n16481-1-AP targets PHAX in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSmall nuclear and small nucleolar RNAs (snRNAs and snoRNAs) are essential components of snRNPs and snoRNPs, and have a critical role in the maturation of, respectively, mRNAs and rRNAs within the nucleus of eukaryotic cells. Complex and specific pathways exist for the assembly of snRNPs and snoRNPs, involving, nucleocytoplasmic transport of snRNAs and intranuclear transport between compartments of snoRNAs. In metazoa, a subset of spliceosomal snRNAs are exported from the nucleus after transcription. This export occurs in a large complex containing a snRNA, the nuclear cap binding complex (CBC), RanGTP, the leucine-rich nuclear export signal receptor CRM1\/Xpo1, and the recently identified phosphoprotein PHAX (phosphorylated adaptor for RNA export). PHAX contains a conserved single-stranded nucleic acid binding domain (RNA_GG_bind domain) with no sequence homology with any other known RNA-binding module [PMID:15574332,11333016, 15574332]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9602 Product name: Recombinant human PHAX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-394 aa of BC021161 Sequence: MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTSRETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF Predict reactive species\nFull Name: phosphorylated adaptor for RNA export\nCalculated Molecular Weight: 394 aa, 44 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC021161\nGene Symbol: PHAX\nGene ID (NCBI): 51808\nRRID: AB_2299663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869727641769,"sku":"16481-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16481-1-ap","provider":"Iright","version":"1.0","type":"link"}