{"product_id":"proteintech-16511-1-ap","title":"Proteintech, 16511-1-AP, SUPT5H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUPT5H (16511-1-AP) by Proteintech is a Polyclonal antibody targeting SUPT5H in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16511-1-AP targets SUPT5H in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUPT5H, also named as DSIF p160, is a 1087 amino acid protein, which belongs to the SPT5 family. SUPT5H localizes in the nucleus and is ubiquitously expressed. SUPT5H is a component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. \nSUPT5H is modified through phosphorylation and methylated, so the molecular weight of SUPT5H might be 140-150 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9728 Product name: Recombinant human SUPT5H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 807-1087 aa of BC024203 Sequence: PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA Predict reactive species\nFull Name: suppressor of Ty 5 homolog (S. cerevisiae)\nCalculated Molecular Weight: 1087 aa, 121 kDa\nObserved Molecular Weight: 140-150 kDa\nGenBank Accession Number: BC024203\nGene Symbol: SUPT5H\nGene ID (NCBI): 6829\nRRID: AB_2878268\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00267\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937212073,"sku":"16511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16511-1-ap","provider":"Iright","version":"1.0","type":"link"}