{"product_id":"proteintech-16594-1-ap","title":"Proteintech, 16594-1-AP, SDS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SDS (16594-1-AP) by Proteintech is a Polyclonal antibody targeting SDS in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16594-1-AP targets SDS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse brain tissue,  rat brain tissue,  rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nL-Serine dehydratase (SDS ; SDH) catalyzes the pyridoxal phosphate (PLP) dependent deamination of l-serine to yield pyruvate. In mammals, SDH is found predominantly in the liver. Extensive studies have been carried out on SDH from rat and the enzyme has been found to play an important role in gluconeogenesis; its activity is induced by the consumption of high-protein diets, starvation and other treatments. The enzyme exists as a dimer of identical subunits, with each subunit exhibiting a bilobal architecture. (PMID: 25380533, PMID: 21878319, PMID: 14646100)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9704 Product name: Recombinant human SDS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC020750 Sequence: MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITR Predict reactive species\nFull Name: serine dehydratase\nCalculated Molecular Weight: 218 aa, 23 kDa\nObserved Molecular Weight: 35 kDa; 70 kDa\nGenBank Accession Number: BC020750\nGene Symbol: SDS\nGene ID (NCBI): 10993\nRRID: AB_3085498\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20132\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887795097769,"sku":"16594-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16594-1-ap","provider":"Iright","version":"1.0","type":"link"}