{"product_id":"proteintech-16619-1-ap","title":"Proteintech, 16619-1-AP, ME1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ME1 (16619-1-AP) by Proteintech is a Polyclonal antibody targeting ME1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16619-1-AP targets ME1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  mouse placenta tissue,  MCF-7 cells,  rat liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nME1(NADP-dependent malic enzyme) belongs to the malic enzymes family. This malic enzyme catalyzes the reversible oxidative decarboxylation of malate and is a link between the glycolytic pathway and the citric acid cycle. The reaction is L-malate plus NADP(+) to form pyruvate, CO(2), and NADPH. The predicted protein contains 572 amino acids and has a calculated molecular mass of 64.1 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9916 Product name: Recombinant human ME1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 226-572 aa of BC025246 Sequence: DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ Predict reactive species\nFull Name: malic enzyme 1, NADP(+)-dependent, cytosolic\nCalculated Molecular Weight: 572 aa, 64 kDa\nObserved Molecular Weight: 55-64 kDa\nGenBank Accession Number: BC025246\nGene Symbol: ME1\nGene ID (NCBI): 4199\nRRID: AB_2143821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48163\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868874002601,"sku":"16619-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16619-1-ap","provider":"Iright","version":"1.0","type":"link"}