{"product_id":"proteintech-16626-1-ap","title":"Proteintech, 16626-1-AP, EPYC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPYC (16626-1-AP) by Proteintech is a Polyclonal antibody targeting EPYC in WB, ELISA applications with reactivity to human, mouse, rat samples\n16626-1-AP targets EPYC in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, human testis tissue,  mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPYC (Epiphycan), also known as DSPG3. It is demonstrated that DSPG3 is expressed in cartilage, as well as ligament and placental tissues (PMID: 8975717). May have a role in bone formation and also in establishing the ordered structure of cartilage through matrix organization. The molecular weight of EPYC is 37 kDa, it is also reported the molecular weight is 62 kDa (PMID: 38184732).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9929 Product name: Recombinant human EPYC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-322 aa of BC030958 Sequence: ESINYDSETYDATLEDLDNLYNYENIPVGKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV Predict reactive species\nFull Name: epiphycan\nCalculated Molecular Weight: 322 aa, 37 kDa\nObserved Molecular Weight: 37kDa, 62 kDa\nGenBank Accession Number: BC030958\nGene Symbol: EPYC\nGene ID (NCBI): 1833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99645\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887626899625,"sku":"16626-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16626-1-ap","provider":"Iright","version":"1.0","type":"link"}