{"product_id":"proteintech-16630-1-ap","title":"Proteintech, 16630-1-AP, S100A12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A12 (16630-1-AP) by Proteintech is a Polyclonal antibody targeting S100A12 in IHC, ELISA applications with reactivity to human samples\n16630-1-AP targets S100A12 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and\/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. S100A12 is expressed abundantly in granulocytes, and has been implicated to play an important role on inﬂammatory reactions in various disease states.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9961 Product name: Recombinant human S100A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC070294 Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE Predict reactive species\nFull Name: S100 calcium binding protein A12\nCalculated Molecular Weight: 92 aa, 11 kDa\nGenBank Accession Number: BC070294\nGene Symbol: S100A12\nGene ID (NCBI): 6283\nRRID: AB_2878290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P80511\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009891497,"sku":"16630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16630-1-ap","provider":"Iright","version":"1.0","type":"link"}