{"product_id":"proteintech-16632-1-ap","title":"Proteintech, 16632-1-AP, HDDC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDDC2 (16632-1-AP) by Proteintech is a Polyclonal antibody targeting HDDC2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n16632-1-AP targets HDDC2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  MCF-7 cells,  PC-3 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHDDC2, also named as C6orf74, plays a role in the maintenance of pluripotency in human ES and iPS cells. HDDC2 is a nuclear‐encoded but mitochondrially localized protein. It has been reported as associated with oxidative metabolism.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9971 Product name: Recombinant human HDDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-218 aa of BC003357 Sequence: MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS Predict reactive species\nFull Name: HD domain containing 2\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC003357\nGene Symbol: HDDC2\nGene ID (NCBI): 51020\nRRID: AB_10597248\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z4H3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887665303721,"sku":"16632-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16632-1-ap","provider":"Iright","version":"1.0","type":"link"}