{"product_id":"proteintech-16645-1-ap","title":"Proteintech, 16645-1-AP, ASL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASL (16645-1-AP) by Proteintech is a Polyclonal antibody targeting ASL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16645-1-AP targets ASL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue,  rat kidney tissue,  rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nArgininosuccinate lyase (ASL), one of the significant UC enzymes, catalyzes argininosuccinate cleavage to generate arginine and fumarate. Arginine is then catalyzed by arginase to ornithine and polyamines, which are found to promote cancer cell proliferation and growth. Importantly, ASL ectopic expression is closely associated with poor prognosis of colorectal cancer, hepatocellular. ASL is a member of the aspartase\/fumarase superfamily. Enzymes of this superfamily share similar tetrameric structure and active site, though the sequence identities between different members are quite low (less than 20%). Members of this superfamily have been recognised as drug targets for microbial infections. ASL is a 464-amino-acid enzyme with a molecular mass of 49.7 kDa. (PMID: 22386318 PMID: 31018905)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10007 Product name: Recombinant human ASL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 114-464 aa of BC008195 Sequence: NDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA Predict reactive species\nFull Name: argininosuccinate lyase\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC008195\nGene Symbol: ASL\nGene ID (NCBI): 435\nRRID: AB_2878293\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04424\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868931936425,"sku":"16645-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16645-1-ap","provider":"Iright","version":"1.0","type":"link"}