{"product_id":"proteintech-16656-1-ap","title":"Proteintech, 16656-1-AP, SPATA19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPATA19 (16656-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA19 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n16656-1-AP targets SPATA19 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human testis tissue,  human liver tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10108 Product name: Recombinant human SPATA19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC058039 Sequence: MIITTWIVYILARKGVGLPFLPITSSDIDVVESEAVSVLHHWLKKTEEEASRGIKEKLSINHPSQGVREKMSTDSPPTHGQDIHVTRDVVKHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIFQVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSMRPSSSDC Predict reactive species\nFull Name: spermatogenesis associated 19\nCalculated Molecular Weight: 167 aa, 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC058039\nGene Symbol: SPATA19\nGene ID (NCBI): 219938\nRRID: AB_1851668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z5L4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869604204713,"sku":"16656-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16656-1-ap","provider":"Iright","version":"1.0","type":"link"}