{"product_id":"proteintech-16721-1-ap","title":"Proteintech, 16721-1-AP, SAA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SAA (16721-1-AP) by Proteintech is a Polyclonal antibody targeting SAA in IHC, ELISA applications with reactivity to human samples\n16721-1-AP targets SAA in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human liver cancer tissue, human liver tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerum amyloid A1(SAA1) is a member of the serum amyloid A family of apolipoproteins. SAA1 is an acute phase apolipoprotein reactant produced mainly by hepatocytes and under regulation of inflammatory cytokines. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA1 protein. Elevated serum SAA1 protein levels may be associated with lung cancer(PMID: 1463770). This antibody can recognize SAA1 and SAA2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10160 Product name: Recombinant human SAA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-122 aa of BC105796 Sequence: SFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Predict reactive species\nFull Name: serum amyloid A1\nCalculated Molecular Weight: 122 aa, 14 kDa\nGenBank Accession Number: BC105796\nGene Symbol: SAA1\nGene ID (NCBI): 6288\nRRID: AB_3085507\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P0DJI8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869428371625,"sku":"16721-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16721-1-ap","provider":"Iright","version":"1.0","type":"link"}