{"product_id":"proteintech-16726-1-ap","title":"Proteintech, 16726-1-AP, GCSH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCSH (16726-1-AP) by Proteintech is a Polyclonal antibody targeting GCSH in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16726-1-AP targets GCSH in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  human liver tissue,  mouse brain tissue,  mouse kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human ovary cancer tissue, human kidney tissue,  human liver tissue,  human ovary tissue,  human skin tissue,  rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCSH(Glycine cleavage system H protein, mitochondrial) is a component of the glycine cleavage system loosely associated with the mitochondrial inner membrane and has lipoic acid as a prosthetic group. The full-length GCSH cDNA encodes a precursor protein of 173 amino acids and a mature protein of 125 amino acids. The lipoylation of H-protein occurs in mitochondria which probably contain an activated form of lipoic acid as well as other components required for the transfer of lipoic acid to the protein(PMID:2211640). Defects in GCSH are a cause of non-ketotic hyperglycinemia (NKH).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10174 Product name: Recombinant human GCSH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC000790 Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE Predict reactive species\nFull Name: glycine cleavage system protein H (aminomethyl carrier)\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC000790\nGene Symbol: GCSH\nGene ID (NCBI): 2653\nRRID: AB_2247351\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23434\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902052009,"sku":"16726-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16726-1-ap","provider":"Iright","version":"1.0","type":"link"}