{"product_id":"proteintech-16757-1-ap","title":"Proteintech, 16757-1-AP, GPT2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPT2 (16757-1-AP) by Proteintech is a Polyclonal antibody targeting GPT2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n16757-1-AP targets GPT2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse kidney tissue,  HepG2 cells\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human skeletal muscle tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPT2 (Alanine aminotransferase 2; ALT2) is a key enzyme in intermediatary metabolism, catalysing the reversible transfer of the amino group of glutamate to pyruvate, yielding alanine and ketoglutarate. GPT2 protein localizes to mitochondria, and is mainly expressed in the pancreas, brain, adrenal gland, skeletal muscle and heart. Serum GPT2 is a useful marker for liver damage. Recently mutation of GPT2 has been reported to be a cause of neural disorder (27601654). 16757-1-AP antibody recognizes two different isoforms of GPT2 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10273 Product name: Recombinant human GPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-523 aa of BC062555 Sequence: VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA Predict reactive species\nFull Name: glutamic pyruvate transaminase (alanine aminotransferase) 2\nCalculated Molecular Weight: 523 aa, 58 kDa\nObserved Molecular Weight: 58 kDa, 47 kDa\nGenBank Accession Number: BC062555\nGene Symbol: GPT2\nGene ID (NCBI): 84706\nRRID: AB_2112098\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TD30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849655977,"sku":"16757-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16757-1-ap","provider":"Iright","version":"1.0","type":"link"}