{"product_id":"proteintech-16797-1-ap","title":"Proteintech, 16797-1-AP, LITAF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LITAF (16797-1-AP) by Proteintech is a Polyclonal antibody targeting LITAF in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n16797-1-AP targets LITAF in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLipopolysaccharide-induced TNF factor(LITAF) is a transcription factor that identified as a regulator of TNF-alpha gene expression. It may has a role in protein degradation pathways and in tumor necrosis factor alpha(TNF-alpha) gene expression. Also it may regulate the expression of the CCL2\/MCP-1 chemokine through NFKB1.Defects in LITAF may be involved in extramammary Paget disease (EMPD) carcinogenesis\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10269 Product name: Recombinant human LITAF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC008309 Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSC Predict reactive species\nFull Name: lipopolysaccharide-induced TNF factor\nCalculated Molecular Weight: 161 aa, 17 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC008309\nGene Symbol: LITAF\nGene ID (NCBI): 9516\nRRID: AB_2135710\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99732\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869469528233,"sku":"16797-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16797-1-ap","provider":"Iright","version":"1.0","type":"link"}