{"product_id":"proteintech-16807-1-ap","title":"Proteintech, 16807-1-AP, SNRPB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPB (16807-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPB in WB, IHC, ELISA applications with reactivity to human samples\n16807-1-AP targets SNRPB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells\nPositive IHC detected in: human cervical cancer tissue, human liver cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNRPB (Small Nuclear Ribonucleoprotein Polypeptides B and B1) is a core component of the spliceosome, a complex molecular machine that plays a critical role in pre-mRNA splicing. This process is essential for the removal of introns and the joining of exons to produce mature mRNA molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10298 Product name: Recombinant human SNRPB protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-234 aa of BC003530 Sequence: MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGKCLQW Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptides B and B1\nCalculated Molecular Weight: 234aa,25 kDa; 285aa,30 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC003530\nGene Symbol: SNRPB\nGene ID (NCBI): 6628\nRRID: AB_2878319\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14678\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960837801,"sku":"16807-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16807-1-ap","provider":"Iright","version":"1.0","type":"link"}