{"product_id":"proteintech-16835-1-ap","title":"Proteintech, 16835-1-AP, Cytokeratin 80 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 80 (16835-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 80 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n16835-1-AP targets Cytokeratin 80 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  human skeletal muscle tissue\nPositive IHC detected in: human skin cancer tissue, human bowen disease,  human colon  cancer,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3600\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKRT80 is a human IF type II epithelial keratin gene involved in the formation of IF heterodimers in various epithelial cells. KRT80 is overexpressed in many neoplasms and plays an essential role in promoting cell proliferation, migration and invasiveness, and is associated with poor prognosis in cancer patients. KRT80 has three isoforms with predicted MW of 50 kDa, 47 kDa, and 54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10498 Product name: Recombinant human KRT80 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-422 aa of BC065180 Sequence: MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAPSLPYPLCSL Predict reactive species\nFull Name: keratin 80\nCalculated Molecular Weight: 422 aa, 47 kDa\nObserved Molecular Weight: 47 kDa, 50 kDa\nGenBank Accession Number: BC065180\nGene Symbol: KRT80\nGene ID (NCBI): 144501\nRRID: AB_1851273\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6KB66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868881440937,"sku":"16835-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16835-1-ap","provider":"Iright","version":"1.0","type":"link"}