{"product_id":"proteintech-16888-1-ap","title":"Proteintech, 16888-1-AP, MTCH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTCH2 (16888-1-AP) by Proteintech is a Polyclonal antibody targeting MTCH2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, rat samples\n16888-1-AP targets MTCH2 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat testis tissue\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10399 Product name: Recombinant human MTCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-178 aa of BC000875 Sequence: GYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGF Predict reactive species\nFull Name: mitochondrial carrier homolog 2 (C. elegans)\nCalculated Molecular Weight: 303 aa, 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC000875\nGene Symbol: MTCH2\nGene ID (NCBI): 23788\nRRID: AB_2266733\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6C9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869611689,"sku":"16888-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16888-1-ap","provider":"Iright","version":"1.0","type":"link"}