{"product_id":"proteintech-16927-1-ap","title":"Proteintech, 16927-1-AP, DDX46 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX46 (16927-1-AP) by Proteintech is a Polyclonal antibody targeting DDX46 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n16927-1-AP targets DDX46 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells,  NIH\/3T3 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX46, also named as KIAA0801, is a 1031 amino acid protein, which belongs to the DEAD box helicase family. DDX46 has been shown to be required at the early step of pre-spliceosome  assembly. It uses the energy released by the hydrolysis of ATP to rearrange local RNA-RNA or protein-RNA interactions. The nuclear DDX46 acted as a negative regulator of the antiviral innate response by recruiting the m6A'eraser' ALKBH5 to induce retention of antiviral innate mRNA in the nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10342 Product name: Recombinant human DDX46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 682-1031 aa of BC012304 Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46\nCalculated Molecular Weight: 1031 aa, 117 kDa\nObserved Molecular Weight: 120-125 kDa\nGenBank Accession Number: BC012304\nGene Symbol: DDX46\nGene ID (NCBI): 9879\nRRID: AB_2090927\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L014\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868979286185,"sku":"16927-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-16927-1-ap","provider":"Iright","version":"1.0","type":"link"}