{"product_id":"proteintech-17169-1-ap","title":"Proteintech, 17169-1-AP, LOH12CR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LOH12CR1 (17169-1-AP) by Proteintech is a Polyclonal antibody targeting LOH12CR1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n17169-1-AP targets LOH12CR1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLOH12CR1, also named as BORCS5, is part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. It may indirectly play a role in cell spreading and motility. LOH12CR1 has two isoforms with MW 17 kDa and 22 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10695 Product name: Recombinant human LOH12CR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC013668 Sequence: MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL Predict reactive species\nFull Name: loss of heterozygosity, 12, chromosomal region 1\nCalculated Molecular Weight: 196 aa, 22 kDa\nObserved Molecular Weight: 17-22 kDa\nGenBank Accession Number: BC013668\nGene Symbol: LOH12CR1\nGene ID (NCBI): 118426\nRRID: AB_2137150\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969J3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868969488553,"sku":"17169-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17169-1-ap","provider":"Iright","version":"1.0","type":"link"}