{"product_id":"proteintech-17171-1-ap","title":"Proteintech, 17171-1-AP, PSCA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSCA (17171-1-AP) by Proteintech is a Polyclonal antibody targeting PSCA in WB, ELISA applications with reactivity to human, mouse samples\n17171-1-AP targets PSCA in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, PC-3 cells,  mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProstate stem cell antigen (PSCA) is a protein composed of 123 amino acid residues. PSCA belongs to the LY-6\/Thy-1 family of cell surface antigens. It is highly expressed in normal prostate and further up-regulated in prostate cancer, as well as non-prostatic malignancies including gastric cancer. PSCA plays a critical role in cell adhesion, proliferation, and survival.  The obasrved MW of PSCA is between 36 to 40 kDa in paper (PMID: 11309275).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10710 Product name: Recombinant human PSCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023582 Sequence: MKAVLLALLMAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHAL Predict reactive species\nFull Name: prostate stem cell antigen\nCalculated Molecular Weight: 123 aa, 13 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC023582\nGene Symbol: PSCA\nGene ID (NCBI): 8000\nRRID: AB_2172635\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43653\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869491220649,"sku":"17171-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17171-1-ap","provider":"Iright","version":"1.0","type":"link"}