{"product_id":"proteintech-17185-1-ap","title":"Proteintech, 17185-1-AP, G-CSF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe G-CSF (17185-1-AP) by Proteintech is a Polyclonal antibody targeting G-CSF in WB, FC (Intra), ELISA applications with reactivity to human samples\n17185-1-AP targets G-CSF in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MOLT-4 cells,  MCF-7 cells,  K-562 cells\nPositive FC (Intra) detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGranulocyte colony-stimulating factor (G-CSF), also referred to as CSF3, is a protective cytokine with anti-inflammatory effects. G-CSF is important in promoting survival of the granulocytic lineage cells and proliferation and migration of neutrophils as well as trophoblast cells. G-CSF acts by binding to its receptor G-CSFR (also called CSF3R), which after binding with G-CSF activates the canonical Janus kinase (Jak)\/signal transducer, activator of transcription (STAT)and Ras\/Raf\/MAP kinase pathways. G-CSF potently stimulates the proliferation and release of peripheral blood progenitor cells into the bloodstream and is therefore used to treat neutropenia after chemotherapy. Furthermore, G-CSF levels are elevated upon intensive exercise leading to increased neutrophil counts, which are predominantly due to delayed neutrophil apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10968 Product name: Recombinant human G-CSF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC033245 Sequence: MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP Predict reactive species\nFull Name: colony stimulating factor 3 (granulocyte)\nCalculated Molecular Weight: 200 aa, 22 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC033245\nGene Symbol: G-CSF\nGene ID (NCBI): 1440\nRRID: AB_2878357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09919\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869462810793,"sku":"17185-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17185-1-ap","provider":"Iright","version":"1.0","type":"link"}