{"product_id":"proteintech-17193-1-ap","title":"Proteintech, 17193-1-AP, RSPO3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSPO3 (17193-1-AP) by Proteintech is a Polyclonal antibody targeting RSPO3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n17193-1-AP targets RSPO3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse small intestine tissue, Transfected HEK-293 cells\nPositive IP detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSPO3, also named as R-spondin-3, is a 272 amino acid protein, which contains 1 TSP type-1 domain and 2 FU (furin-like) repeats. RSPO3 may be a secreted protein and belongs to the R-spondin family. RSPO3 is expressed at higher level in placenta, small intestine, fetal thymus and lymph node. RSPO3 is an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. The four R-spondins (RSPO1-4) and three related leucinerich repeat-containing G-protein coupled receptors, LGR4, LGR5, and LGR6 (LGR4-6), constitute a ligand-receptor system that plays critical roles in development, stem cell survival, and oncogenesis. Ectopic expression of RSPO2\/3in mouse mammary epithelial cells led to an increase in invasiveness in vitro and in tumor formation and metastasis in vivo.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag9899 Product name: Recombinant human RSPO3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-272 aa of BC022367 Sequence: GRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH Predict reactive species\nFull Name: R-spondin 3 homolog (Xenopus laevis)\nCalculated Molecular Weight: 272 aa, 31 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC022367\nGene Symbol: RSPO3\nGene ID (NCBI): 84870\nRRID: AB_2878360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908474537,"sku":"17193-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17193-1-ap","provider":"Iright","version":"1.0","type":"link"}