{"product_id":"proteintech-17207-1-ap","title":"Proteintech, 17207-1-AP, LYZL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYZL1 (17207-1-AP) by Proteintech is a Polyclonal antibody targeting LYZL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17207-1-AP targets LYZL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: human testis tissue, human lung tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:100-1:500\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYZL1(Lysozyme-like 1) is also named as LYC2 and belongs to the glycosyl hydrolase 22 family. It is involved in the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. LYZL1 has two isoforms with the molecular weight of 17 kDa and 22 kDa. The full length protein has a signal peptide of 19 amino acids and a glycosylation site. This antibody detects the N-terminal of LYZL1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10986 Product name: Recombinant human LYZL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC021730 Sequence: MQDAPLSCLSPTRWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAPTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS Predict reactive species\nFull Name: lysozyme-like 1\nCalculated Molecular Weight: 194 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC021730\nGene Symbol: LYZL1\nGene ID (NCBI): 84569\nRRID: AB_2138916\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UWQ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869705719977,"sku":"17207-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17207-1-ap","provider":"Iright","version":"1.0","type":"link"}