{"product_id":"proteintech-17209-1-ap","title":"Proteintech, 17209-1-AP, CEACAM21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEACAM21 (17209-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM21 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n17209-1-AP targets CEACAM21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarcinoembryonic antigen-related cell adhesion molecule 21 (CEACAM21) is a member of the CEACAM family that has diverse functions in cell adhesion, in intracellular and intercellular signaling, and during complex biological processes such as cancer progression, inflammation, angiogenesis, and metastasis (PMID: 23903773; 32488569). CEACAM21 acts as a heterophilic ligand for TIM-3, leading to the dissociation of Bat3 and increasing proximal TCR signaling and proapoptotic protein expression in late effector T cells, thereby mediating T cell suppression (PMID: 38490257).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10992 Product name: Recombinant human CEACAM21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC012001 Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS Predict reactive species\nFull Name: carcinoembryonic antigen-related cell adhesion molecule 21\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012001\nGene Symbol: CEACAM21\nGene ID (NCBI): 90273\nRRID: AB_2077481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3KPI0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886444204201,"sku":"17209-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17209-1-ap","provider":"Iright","version":"1.0","type":"link"}