{"product_id":"proteintech-17232-1-ap","title":"Proteintech, 17232-1-AP, TLR7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLR7 (17232-1-AP) by Proteintech is a Polyclonal antibody targeting TLR7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n17232-1-AP targets TLR7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, Jurkat cells\nPositive IHC detected in: human lung tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAmong the TLR family, TLR7 (toll-like receptor 7) is an endosomal innate immune sensor that can detect single-stranded ribonucleic acid. Constitutive expression of TLR7 is pre-dominant in dendritic cells and B cells compared to other immune cells. Low levels of TLR7 expression have been observed in non-immune cells, such as hepatocytes, epithelial cells, and keratinocytes (PMID: 37596656).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11073 Product name: Recombinant human TLR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-348 aa of BC033651 Sequence: LLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLS Predict reactive species\nFull Name: toll-like receptor 7\nCalculated Molecular Weight: 1049 aa, 121 kDa\nObserved Molecular Weight: 121 kDa, 100 kDa\nGenBank Accession Number: BC033651\nGene Symbol: TLR7\nGene ID (NCBI): 51284\nRRID: AB_2203464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYK1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899594409,"sku":"17232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17232-1-ap","provider":"Iright","version":"1.0","type":"link"}