{"product_id":"proteintech-17276-1-ap","title":"Proteintech, 17276-1-AP, EFCAB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EFCAB1 (17276-1-AP) by Proteintech is a Polyclonal antibody targeting EFCAB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17276-1-AP targets EFCAB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IHC detected in: human colon tissue, human liver tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEFCAB1, also known as Calaxin, is a gene that encodes a protein involved in the function of cilia and flagella, which are hair-like structures protruding from the surface of certain cells. Research indicates that EFCAB1 overexpression inhibits cell proliferation, migration, and invasion while promoting apoptosis in lung adenocarcinoma cells. This suggests that EFCAB1 could potentially serve as a biomarker for lung adenocarcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11039 Product name: Recombinant human EFCAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC025676 Sequence: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM Predict reactive species\nFull Name: EF-hand calcium binding domain 1\nCalculated Molecular Weight: 211 aa, 24 kDa\nGenBank Accession Number: BC025676\nGene Symbol: EFCAB1\nGene ID (NCBI): 79645\nRRID: AB_2878375\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HAE3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869678129321,"sku":"17276-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17276-1-ap","provider":"Iright","version":"1.0","type":"link"}