{"product_id":"proteintech-17277-1-ap","title":"Proteintech, 17277-1-AP, LARP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LARP2 (17277-1-AP) by Proteintech is a Polyclonal antibody targeting LARP2 in WB, IHC, ELISA applications with reactivity to human, mouse  samples\n17277-1-AP targets LARP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse  samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  PC-3 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe La-related proteins (LARPs) share a conserved RNA-binding unit composed of a La Motif and an RNA Recognition Motif (RRM), which recognizes diverse RNA substrates. LARP2 has nine isoforms with MW 30-40 kDa, 90-105 kDa. Alternative splicing has been observed at this locus and multiple variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined. (PMID: 26501340, PMID: 33292040)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11043 Product name: Recombinant human LARP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC030516 Sequence: MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE Predict reactive species\nFull Name: La ribonucleoprotein domain family, member 2\nCalculated Molecular Weight: 201 aa, 24 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC030516\nGene Symbol: LARP2\nGene ID (NCBI): 55132\nRRID: AB_2918052\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q659C4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869702148265,"sku":"17277-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17277-1-ap","provider":"Iright","version":"1.0","type":"link"}