{"product_id":"proteintech-17285-1-ap","title":"Proteintech, 17285-1-AP, SLC39A5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A5 (17285-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17285-1-AP targets SLC39A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue,  mouse pancreas tissue,  rat kidney tissue,  rat liver tissue,  rat pancreas tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC39A5 (Zip5) belongs to the ZIP family of metal ion transporters which function to transport zinc and\/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Most of ZIP members have eight predicted transmembrane domains and similar predicted topologies with the N- and C-termini of the protein located on the extracytoplasmic face of the membrane. Zip5 is a zinc uptake transporter that is specific for Zn(II) over other potential metal ion substrates. ZIP5 gene is most actively expressed in tissues involved in zinc homeostasis (intestine, visceral endoderm, pancreas) but is not induced during zinc deficiency. ZIP5 is localized to the basolateral surface of these cells under zinc-replete conditions but is internalized during periods of dietary zinc deficiency. These observations suggest that Zip5 plays a central role in controlling organismal zinc status. This antibody was generated against the N-terminal region of human SLC39A5 and is predicted to detect the endogenous level of SLC39A5 protein. The calculated molecular weight of SLC39A5 is 56 kDa. With glycosylation modification, the molecular weight of SLC39A5 will be migrated to 70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11067 Product name: Recombinant human SLC39A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-215 aa of BC027884 Sequence: GSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQS Predict reactive species\nFull Name: solute carrier family 39 (metal ion transporter), member 5\nCalculated Molecular Weight: 539 aa, 56 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC027884\nGene Symbol: SLC39A5\nGene ID (NCBI): 283375\nRRID: AB_2923566\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZMH5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869766111401,"sku":"17285-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17285-1-ap","provider":"Iright","version":"1.0","type":"link"}