{"product_id":"proteintech-17296-1-ap","title":"Proteintech, 17296-1-AP, RPS4Y1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPS4Y1 (17296-1-AP) by Proteintech is a Polyclonal antibody targeting RPS4Y1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17296-1-AP targets RPS4Y1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells,  A2780 cells,  HeLa cells,  mouse ovary tissue,  mouse testis tissue,  SKOV-3 cells\nPositive IHC detected in: human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPS4Y1, a Y-linked gene in the human, encodes a subunit of ribosomal protein S4, a component of the 40S subunit and 60S subunit. Ribosomal protein S4 is the only ribosomal protein known to be encoded by more than one gene, namely this gene, RPS4Y2 and the ribosomal protein S4, X-linked (RPS4X). RPS4Y maps to a 90-kb segment that has been implicated in Turner syndrome. As a homolog with RPS4X, the antibody can recognize endogenous level of RPS4Y and RPS4X, at 29-32kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11176 Product name: Recombinant human RPS4Y1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-263 aa of BC010286 Sequence: KKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG Predict reactive species\nFull Name: ribosomal protein S4, Y-linked 1\nCalculated Molecular Weight: 263 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC010286\nGene Symbol: RPS4Y1\nGene ID (NCBI): 6192\nRRID: AB_2180889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P22090\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869590311081,"sku":"17296-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17296-1-ap","provider":"Iright","version":"1.0","type":"link"}