{"product_id":"proteintech-17348-1-ap","title":"Proteintech, 17348-1-AP, SLC25A18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A18 (17348-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A18 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples\n17348-1-AP targets SLC25A18 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse kidney tissue,  mouse heart tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A18, also named as GC 2, belongs to the mitochondrial transporter family (SLC25). It is located in inner mitochondrial membrane which involved in the transport of glutamate either with H+or in exchange for OH-. SLC25A18 is highly expressed in brain, testis, lung, kidney, liver, spleen and skeletal muscle. 17348-1-AP antibody detects the band around 32-35 kDa in SDS-PAGE.   (PMID: 14598172)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11420 Product name: Recombinant human SLC25A18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-228 aa of BC031644 Sequence: LAKTRLQNQHGKAMYKGMIDCLMKTARAEGFFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVTCPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSG Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier), member 18\nCalculated Molecular Weight: 315 aa, 34 kDa\nObserved Molecular Weight: 32-35 kDa\nGenBank Accession Number: BC031644\nGene Symbol: SLC25A18\nGene ID (NCBI): 83733\nRRID: AB_2189889\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H1K4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869499904169,"sku":"17348-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17348-1-ap","provider":"Iright","version":"1.0","type":"link"}