{"product_id":"proteintech-17366-1-ap","title":"Proteintech, 17366-1-AP, TNFAIP8L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TNFAIP8L1 (17366-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP8L1 in IHC, IP, ELISA applications with reactivity to human, mouse samples\n17366-1-AP targets TNFAIP8L1 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNFAIP8L1, also known as TIPE1, is a member of the TNFAIP8 family. TNFAIP8L1 possesses anti-apoptotic and pro-tumorigenic properties, which are crucial for tumor initiation and progression as well as the immune system's ability to combat cancer. TNFAIP8L1 is highly expressed in most cancer cell lines, particularly in cells transformed by viral genomes. The calculated molecular weight of TNFAIP8L1 is 21 kDa. (PMID: 36254562, PMID: 38065896, PMID: 21600655)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10778 Product name: Recombinant human TNFAIP8L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC017672 Sequence: MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAVGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL Predict reactive species\nFull Name: tumor necrosis factor, alpha-induced protein 8-like 1\nCalculated Molecular Weight: 186 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC017672\nGene Symbol: TNFAIP8L1\nGene ID (NCBI): 126282\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVP5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887834288297,"sku":"17366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17366-1-ap","provider":"Iright","version":"1.0","type":"link"}