{"product_id":"proteintech-17376-1-ap","title":"Proteintech, 17376-1-AP, MAPK11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAPK11 (17376-1-AP) by Proteintech is a Polyclonal antibody targeting MAPK11 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17376-1-AP targets MAPK11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, human heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAPK11(Mitogen-activated protein kinase 11) is also named as PRKM11, SAPK2, SAPK2B,p38b and belongs to the MAP kinase subfamily.It is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors.In mouse brain, both p38a and p38b are present in neurons, while p38b is also expressed in glial cells(PMID:15748168).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11184 Product name: Recombinant human MAPK11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-364 aa of BC027933 Sequence: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ Predict reactive species\nFull Name: mitogen-activated protein kinase 11\nCalculated Molecular Weight: 364 aa, 41 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC027933\nGene Symbol: MAPK11\nGene ID (NCBI): 5600\nRRID: AB_2297482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15759\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868983775401,"sku":"17376-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17376-1-ap","provider":"Iright","version":"1.0","type":"link"}