{"product_id":"proteintech-17400-1-ap","title":"Proteintech, 17400-1-AP, FGF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGF1 (17400-1-AP) by Proteintech is a Polyclonal antibody targeting FGF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17400-1-AP targets FGF1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse spinal cord tissue,  mouse heart tissue,  rat heart tissue,  rat brain tissue\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  human lung cancer tissue,  mouse brain tissue,  rat brain tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11366 Product name: Recombinant human FGF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC032697 Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Predict reactive species\nFull Name: fibroblast growth factor 1 (acidic)\nCalculated Molecular Weight: 155 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC032697\nGene Symbol: FGF1\nGene ID (NCBI): 2246\nRRID: AB_2103758\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05230\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868954874025,"sku":"17400-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17400-1-ap","provider":"Iright","version":"1.0","type":"link"}