{"product_id":"proteintech-17430-1-ap","title":"Proteintech, 17430-1-AP, MAGT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAGT1 (17430-1-AP) by Proteintech is a Polyclonal antibody targeting MAGT1 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n17430-1-AP targets MAGT1 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, COLO 320 cells,  HEK-293 cells,  mouse colon tissue,  mouse heart tissue,  rat cerebellum tissue\nPositive IHC detected in: human colon cancer tissue, human liver tissue,  human skeletal muscle tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: C2C12 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAGT1 is a mammalian Mg2+-selective transporter being required for cellular magnesium uptake and vertebrate embryonic development. It possesses five putative transmembrane (TM) regions with a cleavage site, a N-glycosylation site, and a number of phosphorylation sites. Recently mutations in MAGT1 has been found to be asscociated with a novel X-linked human immunodeficiency. The MAGT1 protein was undetectable in the patients'cells by western blot or immunofluorescent cell surface staining. MAGT1 had been detected as 38 kDa (PMID: 18705540) or 45-47 kDa (PMID: 27383987) by western blot.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11496 Product name: Recombinant human MAGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-182 aa of BC060842 Sequence: KKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRVIR Predict reactive species\nFull Name: magnesium transporter 1\nCalculated Molecular Weight: 335 aa, 38 kDa\nObserved Molecular Weight: 45-47 kDa\nGenBank Accession Number: BC060842\nGene Symbol: MAGT1\nGene ID (NCBI): 84061\nRRID: AB_2138982\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H0U3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879573161,"sku":"17430-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17430-1-ap","provider":"Iright","version":"1.0","type":"link"}