{"product_id":"proteintech-17456-1-ap","title":"Proteintech, 17456-1-AP, FABP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FABP7 (17456-1-AP) by Proteintech is a Polyclonal antibody targeting FABP7 in WB, ELISA applications with reactivity to human samples\n17456-1-AP targets FABP7 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFABP7 (Fatty Acid Binding Protein-7), also known as B-FABP (Brain Fatty Acid-Binding Protein), is a member of FABP family which are intracellular proteins involved in lipid metabolism. Normally FABP7 is mainly expressed in brain and other neural tissues and is important in early nervous system development. In addition, FABP7 is considered a marker for some brain tumors and may have a role in tumorigenesis in the peripheral nervous system and in several extra nervous system neoplasms such as breast cancer, renal cancer, and melanoma. This antibody was raised against the full-length human FABP7 and may cross-react with other FABPs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag10990 Product name: Recombinant human FABP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC012299 Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Predict reactive species\nFull Name: fatty acid binding protein 7, brain\nCalculated Molecular Weight: 132aa,15 kDa; 166aa,19 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC012299\nGene Symbol: FABP7\nGene ID (NCBI): 2173\nRRID: AB_2100357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15540\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887629357225,"sku":"17456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17456-1-ap","provider":"Iright","version":"1.0","type":"link"}