{"product_id":"proteintech-17462-1-ap","title":"Proteintech, 17462-1-AP, Plasminogen Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Plasminogen (17462-1-AP) by Proteintech is a Polyclonal antibody targeting Plasminogen in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n17462-1-AP targets Plasminogen in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human blood tissue,  human placenta tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlasminogen is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasminogen plays an important role in fibrinolysis as well as wound healing, cell migration, tissue modeling and angiogenesis. Plasminogen is synthesized in the liver, and it circulates in the blood, with a half-life of 2.2 days. Plasminogen is the precursor of plasmin, which lyses fibrin clots to fibrin degradation products (FDP) and D-dimer; the conversion to active protease is mediated by tissue-type (tPA) and urokinase-type (uPA) plasminogen activators. Defects in plasminogen are likely a cause of thrombophilia and ligneous conjunctivitis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11217 Product name: Recombinant human PLG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-464 aa of BC060513 Sequence: YLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAP Predict reactive species\nFull Name: plasminogen\nCalculated Molecular Weight: 810 aa, 91 kDa\nObserved Molecular Weight: 97 kDa\nGenBank Accession Number: BC060513\nGene Symbol: Plasminogen\nGene ID (NCBI): 5340\nRRID: AB_10644136\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00747\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869486862505,"sku":"17462-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17462-1-ap","provider":"Iright","version":"1.0","type":"link"}