{"product_id":"proteintech-17469-1-ap","title":"Proteintech, 17469-1-AP, FMO3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FMO3 (17469-1-AP) by Proteintech is a Polyclonal antibody targeting FMO3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n17469-1-AP targets FMO3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:100-1:500\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMicrosomal flavin-containing monooxygenase (FMO) catalyzes the FAD-, NADPH-, and O2-dependent oxidation of a large number of xenobiotics containing soft nucleophiles,including alkaloids, pesticides, and pharmaceutical substances.Based on the cDNA sequence, the FMOs are classified into five subfamilies (FMO1 to FMO5) (PMID:11792679).In human beings, FMO3 is predominant in the adult liver, but not appear sex-dependent in the adult human liver. In the mouse liver, its expression has been shown to be sex-dependent and expressed only in females (PMID:11996886). Defects in FMO3 are the cause of trimethylaminuria (TMAU). This antibody is specific to FMO3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11405 Product name: Recombinant human FMO3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-351 aa of BC032016 Sequence: EPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYMKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEII Predict reactive species\nFull Name: flavin containing monooxygenase 3\nCalculated Molecular Weight: 532 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC032016\nGene Symbol: FMO3\nGene ID (NCBI): 2328\nRRID: AB_2878410\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31513\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955070633,"sku":"17469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17469-1-ap","provider":"Iright","version":"1.0","type":"link"}