{"product_id":"proteintech-17542-1-ap","title":"Proteintech, 17542-1-AP, TRIM29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM29 (17542-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM29 in WB, IHC, ELISA applications with reactivity to human samples\n17542-1-AP targets TRIM29 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, A431 cells,  BGC-823 cells\nPositive IHC detected in: human skin cancer tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM29(Tripartite motif-containing protein 29) is also named as ATDC( Ataxia telangiectasia group D-associated protein). ATDC protein physically interacted with the intermediate filament protein vimentin, a protein kinase C substrate and colocalizing protein, and with an inhibitor of protein kinase C, PKCI1 (PMID:7644499). Knockdown of TRIM29 in airway epithelial cells enhances type I interferon production, and in human nasopharyngeal carcinoma cells results in almost complete Epstein-Barr virus clearance. TRIM29 is also highly induced by cytosolic double-stranded DNA in myeloid dendritic cells (PMID: 29038422). Western detected both full-length TRIM29 (65 kDa) and a truncated variant of TRIM29 with a molecular weight of about 50 kDa (PMID: 26095369).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11600 Product name: Recombinant human TRIM29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-588 aa of BC017352 Sequence: DQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP Predict reactive species\nFull Name: tripartite motif-containing 29\nCalculated Molecular Weight: 588 aa, 66 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC017352\nGene Symbol: TRIM29\nGene ID (NCBI): 23650\nRRID: AB_2272412\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14134\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909129897,"sku":"17542-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17542-1-ap","provider":"Iright","version":"1.0","type":"link"}