{"product_id":"proteintech-17561-1-ap","title":"Proteintech, 17561-1-AP, SHOC2\/Sur-8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHOC2\/Sur-8 (17561-1-AP) by Proteintech is a Polyclonal antibody targeting SHOC2\/Sur-8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n17561-1-AP targets SHOC2\/Sur-8 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Jurkat cells,  mouse brain tissue,  rat testis tissue,  U-251 cells\nPositive IHC detected in: human renal cell carcinoma tissue, human kidney tissue,  mouse brain tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHOC2 is also named as Sur-8. The SHOC2 protein, along with MRAS and PP1C, forms a high affinity, heterotrimeric holoenzyme that activates RAF kinases by dephosphorylating a specific phosphoserine (PMID: 37074066). SHOC2, a key protein mediating the Ras-Raf-ERK pathway,  could act as a scaffolding protein to facilitate the activation of the pathway by mediating the interaction of key  components of the pathway (PMID: 37170083). The scaffold protein Shoc2 is a critical modulator of ERK1\/2 signals, and mutations in the shoc2 gene lead to the human developmental disease known as Noonan-like syndrome with loose anagen hair (NSLH) (PMID: 36265687).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11754 Product name: Recombinant human SHOC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-583 aa of BC050445 Sequence: GELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV Predict reactive species\nFull Name: soc-2 suppressor of clear homolog (C. elegans)\nCalculated Molecular Weight: 582 aa, 65 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC050445\nGene Symbol: SHOC2\/Sur-8\nGene ID (NCBI): 8036\nRRID: AB_2188463\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UQ13\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868960706729,"sku":"17561-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17561-1-ap","provider":"Iright","version":"1.0","type":"link"}