{"product_id":"proteintech-17598-1-ap","title":"Proteintech, 17598-1-AP, MED20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED20 (17598-1-AP) by Proteintech is a Polyclonal antibody targeting MED20 in WB, ELISA applications with reactivity to human samples\n17598-1-AP targets MED20 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMED20(Mediator of RNA polymerase II transcription subunit 20) is also named as TRFP and belongs to the Mediator complex subunit 20 family. The deduced 209-amino acid protein shares 44% amino identity with Drosophila Trfp. TRFP had an apparent molecular mass of 28 kD by SDS-PAGE. It is identified TRFP as a component of an RNA polymerase II-SRB complex. The TRFP-containing complex could substitute for core RNA polymerase II in driving basal transcription from a minimal promoter.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag11598 Product name: Recombinant human MED20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC040950 Sequence: MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR Predict reactive species\nFull Name: mediator complex subunit 20\nCalculated Molecular Weight: 212 aa, 23 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC040950\nGene Symbol: MED20\nGene ID (NCBI): 9477\nRRID: AB_2142162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H944\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869471494313,"sku":"17598-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-17598-1-ap","provider":"Iright","version":"1.0","type":"link"}